- Prostaglandin E Synthase Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Supplier Product Page
- NBP1-87852
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Prostaglandin E Synthase
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human, Mouse
- 0.1 ml (also 25ul)
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: ITGQVRLRKK AFANPEDALR HGGPQYCRSD PDVERCLRAP RNDM
- MGST-IV, MGST1-L1, MGST1L1, MPGES, PGES, PIG12, PP102, PP1294, TP53I12, mPGES-1
- prostaglandin E synthase
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM
Specifications/Features
Available conjugates: Unconjugated